SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720199|ref|YP_007068193.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720199|ref|YP_007068193.1|
Domain Number 1 Region: 108-317
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.88e-36
Family ATP-binding domain of peptide synthetases 0.0064
Further Details:      
 
Domain Number 2 Region: 31-108
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.0000129
Family D-Alanine ligase N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720199|ref|YP_007068193.1|
Sequence length 325
Comment D-alanine--D-alanine ligase [Calothrix sp. PCC 7507]
Sequence
MIIGLCYDLKREYLQQGFSPTDVMEFDDEETIIGLEDTLCNLGHRVERIGNGRKLALRLA
KGDRWDLVFNIAEGIKGRSREAQVPAICELFAQPYTFSDPLTCALTLDKALAKRIVRDRG
LPTAPFAIINHIAEAANISLPMPLFLKPVAEGSSKGITGKSLVKEQQELVAAYQALHSQF
HQPILVEPFLPGREVTVGIIGNGSHAKVVGVMEVIFTDQAETDAYTTLNKKEYLDRVAYQ
LLIDPEPLAMQAQQLALDVYNTFSCRDAARVDLRCDAGGVLQFLEVNPLPGLDHIYSDLP
IMGRLAGVTYTEIIAAILDAAWQRY
Download sequence
Identical sequences K9PRF7
WP_015131152.1.42896 gi|427720199|ref|YP_007068193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]