SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720223|ref|YP_007068217.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720223|ref|YP_007068217.1|
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.5e-52
Family Hypothetical protein TT1808 (TTHA1514) 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427720223|ref|YP_007068217.1|
Sequence length 204
Comment hypothetical protein Cal7507_5034 [Calothrix sp. PCC 7507]
Sequence
MVQTPTNPETETLLIELPSTIGLHVTQEQFAALAVANRDLRLERTAQGELIVNPPTGWET
GERNWSISGELYLWWRNSGEPGKAFDSSTGFILPNGATRSPDASWVSQERWEALTPEQKG
TFANICPDFVVELRSSSDSLKSLQAKMREYIDNGALLGWLIDPQQRRVEVYRPELAVEVL
ENPAELSGETVLPGFVLNLRRVWD
Download sequence
Identical sequences K9PQL6
WP_015131176.1.42896 gi|427720223|ref|YP_007068217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]