SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720263|ref|YP_007068257.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427720263|ref|YP_007068257.1|
Domain Number - Region: 30-105
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0036
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720263|ref|YP_007068257.1|
Sequence length 174
Comment hypothetical protein Cal7507_5078 [Calothrix sp. PCC 7507]
Sequence
MENWFFINWRAIFVPSISVLELFIRGSLVYLALFSVLRFLPSRQLGTLGITDLLVVVLFA
EAAQNAMTSNYTSITEGAILVGTVIVWSYLFNWLGYKLPEFQKILNPPPLLLVKNGRMIQ
RHLQKELITNDELMSKLRQQGVEFLTDVKLAFMEADGSISIITSESQTSITDKQ
Download sequence
Identical sequences K9PQP8
WP_015131214.1.42896 gi|427720263|ref|YP_007068257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]