SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720322|ref|YP_007068316.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720322|ref|YP_007068316.1|
Domain Number 1 Region: 99-468
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.23e-97
Family Amylase, catalytic domain 0.00000984
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000143
Family AMPK-beta glycogen binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 473-551
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000345
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720322|ref|YP_007068316.1|
Sequence length 552
Comment 1,4-alpha-glucan-branching protein [Calothrix sp. PCC 7507]
Sequence
MPQPIEFKLFAPYNKGVALIGSFSDWQDLPMEKGEDGYFRTTVELEDGDYQYKFRVQSNS
WFFEPEQWVEVTDPYATDIDESSGKDNAIVRIKDGAKILDTYVWQHDDKPLPADHELVIY
ELHVGDFSGGEDDPYARGKYKHVIEKLDYLSDLGINAIELMPIKEYPGDYSWGYNPRHFF
ATESSYGSTDGLKRLIDECHNRGIRVIMDGIYNHSEASAPLTQIDHDYWYHHSPRDPDNN
WGPEFNYELYDEKLDTFPARKFIGETVRFWIEEYHIDGIRYDAARQIANYDFMHWIVQET
KKTAGNKPFYNVAEHIPETPSITNLDGPMDGCWHDSFLHTVLAHICGETFDLENLKDVID
AKRQGFLGATNVVNYLTNHDHEHIMVELANRNIFNEEAFRRAKLGGAILMTAVGVPLIWM
GEEFGEYKPKQPESSKIDWTLLGNELNSSLFEYYKGLVNLRKNSHALYTENIDFIHENLE
SKVLAYSRWNEEGSRVVVVANFSENFLAGYHVPNFPCGGTWHEWTSNYDVEAGEDGIITD
IGPYEAKVFVWQ
Download sequence
Identical sequences K9PSE6
gi|427720322|ref|YP_007068316.1| WP_015131273.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]