SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720531|ref|YP_007068525.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720531|ref|YP_007068525.1|
Domain Number 1 Region: 379-636
Classification Level Classification E-value
Superfamily PP2C-like 1.31e-51
Family PP2C-like 0.00013
Further Details:      
 
Weak hits

Sequence:  gi|427720531|ref|YP_007068525.1|
Domain Number - Region: 159-246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000196
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 
Domain Number - Region: 5-55
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427720531|ref|YP_007068525.1|
Sequence length 647
Comment protein serine/threonine phosphatase [Calothrix sp. PCC 7507]
Sequence
MLICPQCKFENSNSNKFCQNCGTSLTHKVCPQCSTSVLVDAQNCHQCGADCGTVWWAIIT
QEATREDSGDEGGISSLPLSSQLVVGSYLDQEQRYQLLESLPNQEETTANKEIGLRVLDC
KPYQISPLGAMLVNQQKGLVTPSAGVSGIPCQAKPYIELKFQGHPGIPLIHDAWQQGNMQ
LVLIQDRLSWQHLLDLWKQDTTSSLQILHWCYQMTQLWSVLEPVNCRQSLLNLSNLRLDE
DQTLALRQLYVENNQSLSEPVDAEVQTVTDQEQPLTIKALGRVWQQLFKQSQRTQFGIIV
QMLGDLEQGKIETIAQLRSRLETIAAELEAPATEIYPLIKEKSTAAATTLLLDEAEDSSN
RNDDMPTVVLPMQLSSLEDAGRTDVGRQRHHNEDYFGIDTKLNKLELPRSRVLQARGLYI
LCDGMGGHAGGEIASELAVNTLRQYFQEHWTTKQLPTEDSIREAVYLANQAIYDLNQQDA
RSGVGRMGTTLVMLLVQDTYAAVAHVGDSRLYRLTRKRGLEQITVDHEVGQREIARGVEA
TIAYARPDAYQLTQALGPRDEHSIKPDVEFFEINEDSLLILASDGLSDNDLLEIHWQNHL
LSLLSSGTNLEGGVTDLIDLANQYNGHDNITAILIRAKVRPNLDSQR
Download sequence
Identical sequences K9PRV4
WP_015131482.1.42896 gi|427720531|ref|YP_007068525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]