SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720535|ref|YP_007068529.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720535|ref|YP_007068529.1|
Domain Number 1 Region: 29-187
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000102
Family Hypothetical protein TT1808 (TTHA1514) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427720535|ref|YP_007068529.1|
Sequence length 255
Comment hypothetical protein Cal7507_5360 [Calothrix sp. PCC 7507]
Sequence
MTLAKPSELGITHLPDHTELPESDGSFVFAERAGGKNFQEHPQSLLLTDSITERLQQLHP
DNQYAIGQDSGIYWRLTDPPERGAEAPDWFYVPNVSPMLNGQYRRSYVLWQEYVAPLIVL
EFVSGDGSDERDNTPISGKFWVYEQAIRVPFYGIYEFSKASVEVYHLVDGRYQLLPANER
GHYPIFPMGVELGIWQGQYKNMEAPWLRWWDAQGNLLLNSDEKSQQLASQLEQQQQKAKR
LAQKLRQLGIEPDDV
Download sequence
Identical sequences K9PQI9
WP_015131486.1.42896 gi|427720535|ref|YP_007068529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]