SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720573|ref|YP_007068567.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720573|ref|YP_007068567.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 4.91e-52
Family Dimethylarginine dimethylaminohydrolase DDAH 0.034
Further Details:      
 
Weak hits

Sequence:  gi|427720573|ref|YP_007068567.1|
Domain Number - Region: 617-696
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00301
Family Pyruvate oxidase and decarboxylase, middle domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427720573|ref|YP_007068567.1|
Sequence length 703
Comment hypothetical protein Cal7507_5398 [Calothrix sp. PCC 7507]
Sequence
MASRIRFLMCAPDHYDVDYVINPWMEGNIHKSSRDRAVEQWQKLHHVLKEHAIVDLVPPQ
KGWPDMVFTANAGLVLGDNVVLSRFLHKERQGEEPHFQQWFEQNGYTVHVLPKDLPFEGA
GDALLDREGRWLWTGYGFRSELDSHPYLAKWLDIEVISLRLTDERFYHLDTCFCPLANGY
LLYYPGAFDAYSNRIIEMRVAPEKRIAIAEADAVNFACNAVNVESIVIMNKASEALKSRL
TDAGFQIIETPLTEFLKAGGAAKCLTLRVTEPVRDEVHANVSVESRIIRLEGHLLDSGLI
NRALDLIVDTGGSFQVLNFNLGEQRQSTSAAEVKVSAPSHEVMEEILSQLIDLGAVNLPQ
DERDAILEPVIQNGVAPDDFYVSTIYPTEVRINGQWVKVQNQRMDGAIAITQTADGSVAK
CKILRDLEVGEQVIVDVLGIRTIRKPESREQRNSQEFSFMSAGVSSERRVELVVEQVAWE
LRKIRDAGGKVAVTAGPVVIHTGGGEHLSRLIREGYVQALLGGNAIAVHDIEQNMMGTSL
GVDMKRGVAVRGGHRHHLKVINIIRRYGSIAKAVEAGIIKSGVMYECIHNQVPFVLAGSI
RDDGPLPDTQMDLIKAQQEYAQLLEGAEMILMLSSMLHSIGVGNMTPAGVKMVCVDINPA
VVTKLSDRGSIESVGVVTDVGLFLSLLTQQLDKLTSPYRAVIG
Download sequence
Identical sequences K9PRJ6
WP_015131524.1.42896 gi|427720573|ref|YP_007068567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]