SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720966|ref|YP_007068960.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720966|ref|YP_007068960.1|
Domain Number 1 Region: 37-141
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.89e-27
Family Pentapeptide repeats 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427720966|ref|YP_007068960.1|
Sequence length 168
Comment pentapeptide repeat-containing protein [Calothrix sp. PCC 7507]
Sequence
MKKILLRLCSLIVILILAGLWIIINPRPAFALTNVINYNNINLENRDFAHEDLTGATFVA
AEMRGANFQGANLTNAVLTKGVLLKADLSDANLTGALVDRVTLDGANLKNAIFTEATLTR
SRFYDAEITGADFTDALIDRYQVSLMCDRAAGINPVTGVSTRDSLGCP
Download sequence
Identical sequences K9PT57
gi|427720966|ref|YP_007068960.1| WP_015131915.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]