SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427721010|ref|YP_007069004.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427721010|ref|YP_007069004.1|
Domain Number 1 Region: 183-643
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.22e-117
Family Amylase, catalytic domain 0.00000000441
Further Details:      
 
Domain Number 2 Region: 651-754
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.64e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00033
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily E set domains 1.16e-17
Family E-set domains of sugar-utilizing enzymes 0.012
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.00000000196
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427721010|ref|YP_007069004.1|
Sequence length 764
Comment 1,4-alpha-glucan-branching protein [Calothrix sp. PCC 7507]
Sequence
MSMTTIAPELVNRIVWNQHQDPFEVLGSHLVELNGKKVWAVRAYLPNASAAWVVLPQERK
EYAMETVHHPNFFECIIETAELTNYQLRIKEGEHERVTYDPYAFRSPNLTDFDLHLFGEG
NHHRLYEKLGAHPTDVDGVKGVYFAVWAPNARNVSLLGDFNNWDGRQHQMRKGATGVWEL
FIPEVGVGEHYKYEIKNFEGHIYEKSDPFGFQQEPRPKTASIVTDLNTYKWSDEDWLEKR
RHTDPLTQPVSVYEVHLGSWLHASSDEPAKLPNGETEAVVTVSELNPGARFLTYRELAER
LIPYVKELGYTHLELLPIAEHPFDGSWGYQVTGYYAPTSRFGTAEDFMYFVDQCHKNDIG
VIVDWVPGHFPKDGHGLAFFDGSHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLVANAL
FWFDKYHIDGIRVDAVASMIYNDYCRKEGEWLPNQYGGRENLDAADFLRQVNSLIFSYFP
GALSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKLANVRCLFSYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWHLFQYEPHQQLKQFFQDLNHLYRSEPTLYTQDFAQEGFEWIDCSD
NRHSVVSFIRRDRYSDDFAIVVCNFTPQPHSHYRIGVPEEGFYTELFNSDARKYGGSNMG
NLGGKWTDQWSLHNRPYSLDLCLPPLGVLVLKLDKVKTAEVIKS
Download sequence
Identical sequences K9PRX5
gi|427721010|ref|YP_007069004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]