SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427721032|ref|YP_007069026.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427721032|ref|YP_007069026.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily CheY-like 2.99e-42
Family CheY-related 0.0005
Further Details:      
 
Weak hits

Sequence:  gi|427721032|ref|YP_007069026.1|
Domain Number - Region: 267-329
Classification Level Classification E-value
Superfamily At5g01610-like 0.00183
Family At5g01610-like 0.014
Further Details:      
 
Domain Number - Region: 168-377
Classification Level Classification E-value
Superfamily PP2C-like 0.00889
Family PP2C-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427721032|ref|YP_007069026.1|
Sequence length 378
Comment response regulator receiver modulated serine phosphatase [Calothrix sp. PCC 7507]
Sequence
MFKILVIDDDRSIQILLKRMLEKQGYQVVIANNGEEGIAKLLTYQPALIICDWIMPGLSG
LEVCHRIKTDPNLSTIFFILLTSLDSVADRVKGLDAGADDFISKPIEQNELQARLRAGLR
LHQLSRDLQIQKQLLEAELAQAAEYVRSLLPLPMTEPLSINSRFVPSRQLGGDCFDYYWL
DPDYLAIYLLDTAGHGLKATLPSVSVLNLLRSRALKSLNYYQPSHVLKALNDTFQISYQN
DKYFTIWYGVYNKVKRQLIYASAGHPPAILVSGKSPNNTKVQLLRTPGMPVGMFPEAVYV
DGFCNIETSSTLYIYSDGAYEITKSDGTVWNLDAFIQLLVSLQYNVDYQLDQVLNYLIAL
HSSEAFDDDLSILQIKFD
Download sequence
Identical sequences K9PUH0
gi|427721032|ref|YP_007069026.1| WP_015131981.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]