SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720699|ref|YP_007068693.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720699|ref|YP_007068693.1|
Domain Number 1 Region: 29-448
Classification Level Classification E-value
Superfamily Clc chloride channel 4.58e-90
Family Clc chloride channel 0.000021
Further Details:      
 
Domain Number 2 Region: 472-605
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-19
Family CBS-domain pair 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720699|ref|YP_007068693.1|
Sequence length 645
Comment Cl- channel voltage-gated family protein [Calothrix sp. PCC 7507]
Sequence
MTLLPPTELRKVTEQPALPSPSAHLAHLINHFQPSPETVVLFLAVLIGGGTGMGVVTFHY
LIQLIHELTLVNLMGTIGGWGAWTLACVPTFGGLIVSLMRWRTQDFGPGLSSLIAASQGT
ELRQQLRPVTKMFAASVSLGSGASLGPEGPSVEIGANFGMLLSIVLQVSQEQQRLLLGAG
AAAGLAAGFNAPIAGVFFALEVVIGATSFATSAVSVVLLAAVVAALIAQIGLGAQPAFAL
PAYQVRSPLELPLYLGLGLGASLVSVAYTQSIRLAKAWFAGQIPGFDFMGRIPKYIHPII
GGVIVGAVALYFPQILGIGYGTVQAMLQDVEFSLQLLVVLLVMKLLMTAISAGSGFVGGL
FAPAMFLGASFGSAYAKVVALVAPIIGAQMAAPPAYAMVGMAAVLAGSVRAPLTAILMLF
ELTRDYRIVLPLMAAVGLSVWLVERIKPTFNSNTNLQQIGLSELKDDKVDILEEILVEDA
MLTCPKKLPATFGVLEAAVEMTRDRCHSALVIDEAEQLIGIVSLEDINRALSSWQNYQNS
PSEIQSNLSSQTLMEICTTEILYAWRDEPLSEALDRMALRGLHQLPVVARDNHERILGLL
EREQITLTCNLALTRKALRRYLPVVSTTDIVISQQSTVNGQYLDS
Download sequence
Identical sequences K9PSV0
gi|427720699|ref|YP_007068693.1| WP_015131650.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]