SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720901|ref|YP_007068895.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720901|ref|YP_007068895.1|
Domain Number 1 Region: 40-322
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.6e-76
Family L-arabinose binding protein-like 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427720901|ref|YP_007068895.1|
Sequence length 327
Comment monosaccharide ABC transporter substrate-binding protein [Calothrix sp. PCC 7507]
Sequence
MNVKKIAIAATLLSIVSGTVVGCTNVPNNGNTATNTDPKNVKLRSVGVTLGDLSNPFFVV
MAQGAEKEAKKIGGDGVRATVVSSGYDLNQQFNQIENFVAANTDMIILNAADSKGIRPAV
DQARQAGKIVIAVDTPVEADVDATVTTNNVQAGEISCQYIADRLKGKGNVVIVNGPPVTS
VIQRVDGCLKVLAKYPNIKLLSKDQNAEGSRDGGLRVMSDLLVTFPKIDAVFAINDPSGV
GVDLAANQAKRQDFFIVGVDGAPEAIQAIASKDSLYAATATQNPRGMTQKAVQVGNDILH
GKKPESPNILIPAKLVTKENVSTSTGW
Download sequence
Identical sequences K9PSY5
gi|427720901|ref|YP_007068895.1| WP_015131850.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]