SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15893012|ref|NP_360726.1| from Rickettsia conorii str. Malish 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15893012|ref|NP_360726.1|
Domain Number 1 Region: 42-152
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000000262
Family Apolipoprotein 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15893012|ref|NP_360726.1|
Sequence length 159
Comment hypothetical protein RC1089 [Rickettsia conorii str. Malish 7]
Sequence
MENIMKKFLITLGATATLLLTSSIFADLPTKDETKANEVQTAEVATSSTKTITENLQELK
DNLTNLAQTGADKFNQTLSNTYDQIAQSVTEIKKNVKDQKDKKGEELQKSIDAVKAKMEA
YKKAGSKKQEKIRQHLVDKLEELNKNINEYNNDKEKANS
Download sequence
Identical sequences Q92GN4
gi|15893012|ref|NP_360726.1| 272944.RC1089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]