SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39933956|ref|NP_946232.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39933956|ref|NP_946232.1|
Domain Number 1 Region: 41-337
Classification Level Classification E-value
Superfamily SIS domain 2.2e-58
Family mono-SIS domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39933956|ref|NP_946232.1|
Sequence length 337
Comment sugar isomerase [Rhodopseudomonas palustris CGA009]
Sequence
MALSKNHTKTPTMSEQAAAAIPSALRTLEAEASGVTALATALQSDLGVRFAATIDLIQNA
KGRLIITGLGKSGHIGRKIAATFASTGTPAFFVHASEASHGDLGMITADDIILAMSWSGE
QPEMKNLINYAKRFKIALVAMTSDSTSTLATAADVSLTLPKAREACPHNLAPTTSSLMML
ALGDALAIALLESRGFTPGDFSVLHPGGKLGAMLKYARDLMHTGEAIPLKPLGTRMSDAL
VEMSAKGFGCVGIIDSNGQIAGIVTDGDLRRNMRSDLMTATVDEVMTRNPKTISPNLLAG
QALELLNSSKITALLVAEGKKPLGIVHLHDLLRAGVA
Download sequence
Identical sequences Q6NBE9
258594.RPA0879 WP_011156414.1.60452 WP_011156414.1.81860 gi|39933956|ref|NP_946232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]