SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39935726|ref|NP_948002.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39935726|ref|NP_948002.1|
Domain Number 1 Region: 244-608
Classification Level Classification E-value
Superfamily SIS domain 3.53e-112
Family double-SIS domain 0.0000000395
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.29e-74
Family Class II glutamine amidotransferases 0.000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39935726|ref|NP_948002.1|
Sequence length 608
Comment glucosamine--fructose-6-phosphate aminotransferase [Rhodopseudomonas palustris CGA009]
Sequence
MCGIIGILGRGPVAEQLVDSLKRLEYRGYDSAGVATLEDGELVRRRAEGKLKNLEAVLKR
QPLAGHVGIGHTRWATHGKPNEANAHPHAASGVAVVHNGIIENFRELRDELEGGGATFAS
ETDTEVVAHLVNSFLVKGLSPQDAVKAALPRLRGAFALAFVFKGYDDLMIGARKGSPLAI
GYGDGEMYLGSDAIALAPLTDDISYLDDGDWVVLTHTTAEVRDAKGDVVKRDVMKSGASS
FVVDKANYRHFMAKEIHEQPEVVGHTLARYLDMASERIALPMKLPFDFKDVQHLSITACG
TANYAGYVAKYWFEQFARLPVEIDIASEFRYREAPLRSGDLAIFISQSGETADTLAALRY
AKEQGLHTLSVVNVPTSTIARESEVVMPTLAGPEIGVASTKAFTCQLTALAALAIAAGRA
RGTLTDADEAKLVHGLIELPRLMAAALTHEPQIERLARDISKAQDVLYLGRGTSYPLALE
GALKLKEISYIHAEGYAAGELKHGPIALIDEKMPVVVIAPYDRVFEKTVSNMQEVAARGG
RIILMTDAKGAEEATVDSMVTIMMPDMPAAFTPMVYAIPVQLLAYHTAVVMGTDVDQPRN
LAKSVTVE
Download sequence
Identical sequences B3QIT9 Q6N6F7
gi|192291312|ref|YP_001991917.1| WP_011158210.1.13849 WP_011158210.1.60452 WP_011158210.1.81860 258594.RPA2660 395960.Rpal_2934 gi|39935726|ref|NP_948002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]