SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39936696|ref|NP_948972.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39936696|ref|NP_948972.1|
Domain Number 1 Region: 403-821
Classification Level Classification E-value
Superfamily SIS domain 9.89e-91
Family Phosphoglucose isomerase, PGI 0.00014
Further Details:      
 
Domain Number 2 Region: 25-392
Classification Level Classification E-value
Superfamily Aldolase 5.37e-80
Family Class I aldolase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39936696|ref|NP_948972.1|
Sequence length 974
Comment bifunctional transaldolase/phosoglucose isomerase [Rhodopseudomonas palustris CGA009]
Sequence
MTSLDPRTEMRARPSSHRTSRQGTMNPVKALEKHGQAIWLDFLARGFIAKGDLKKLIETD
GVKGVTSNPSIFEKAIGASDEYDGAIGEALKKGDRSVGDLYETLAVEDIQNAADVLRPVY
DKLEHRDGFVSLEVSPYLAIDTKGTLAEAERLWRAVNRENLMIKVPATREGLPAIKQLVS
KGISVNVTLLFSQKVYVQVAEAYIAGLEALIASGGDPAHVASVASFFISRIDSAVDAALD
DKIAKANDPSEKERLEELKGKVAIANAKLAYQDYKRLFSGDRWAKLEACGAKPQRLLWAS
TGTKNKAYSDVMYIEELIGQNTVNTVPPATLDAFRDHGEPRNSLEKDLDEARAVIKGLAS
TGVSLDAITDKLVTEGVQLFADAFDKLLGAVAFKRETVLAGRVGKQTLSLPGELANSVKQ
HTEAWRSAGKIRKIWSRDESVWTDHDEGKWLGWLHAPSVAKTKLTEYQDFAKWVKSQGFT
DAVVLGMGGSSLGPEVIAETFPQQDGFPKLHVLDSTDPAQVRALEASVKLASTLFIVSSK
SGGTTEPNVMKAYFFARVTEAIGADQAGRHFVAVTDPGSSMEKVATEQKFAKIFHGDPTI
GGRYSVLSPFGLVPAAAAGIDLAKLLDSALAMVRSCGTDVPPQQNPAVQLGLVMGCAGLE
GRDKVTITSSKAIADFGAWAEQLIAESTGKEGKGLIPIDGEPLADPSAYGNDRLFIDLRT
EAETDAAHEAKLAALEAAGHPVVRIVLKSTEAIGQEFFRFELATAVAGAVLGINPFDQPD
VESAKIKTRELTAAFEKSGALPAETPALSTAEADLYTDAGNAAALRKAGADGTVASWLKA
HLSRVSAGDYVALLAYIERNAAHIEALQDIRLKVRDHRKVATCAEFGPRFLHSTGQAYKG
GPDSGVFLQITADDAADLPVPGQSASFGVIKAAQARGDFDVLTERGRRALRVHLKGDLGA
GLKSLGTAIKQALE
Download sequence
Identical sequences Q6N3Q9
258594.RPA3634 gi|39936696|ref|NP_948972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]