SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39936988|ref|NP_949264.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39936988|ref|NP_949264.1|
Domain Number 1 Region: 65-209
Classification Level Classification E-value
Superfamily SIS domain 2.02e-35
Family mono-SIS domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|39936988|ref|NP_949264.1|
Sequence length 222
Comment phosphoheptose isomerase [Rhodopseudomonas palustris CGA009]
Sequence
MTQSRNSTAPIPDDVPEDVAATPLLSKRQMLGYYDHLRATLAAAQASDCEGRPFAQEVAA
SLVIAWAREVHADGRKLMFIGNGGSAAIASHMATDYSKNGGMRALCLNDGAMLTCLGNDY
GYEQVFAKQIELFAQEGDLLIAISSSGRSPNILNAVAAARARGCRVITLSGFSADNPLRR
EGDINFYLASDQYGFVELGHLTICHAILDFACGQRVPLPAAG
Download sequence
Identical sequences Q6N2X1
gi|39936988|ref|NP_949264.1| 258594.RPA3927 WP_011159463.1.60452 WP_011159463.1.81860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]