SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39937048|ref|NP_949324.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39937048|ref|NP_949324.1|
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily SIS domain 5.06e-49
Family mono-SIS domain 0.00000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39937048|ref|NP_949324.1|
Sequence length 195
Comment phosphoheptose isomerase [Rhodopseudomonas palustris CGA009]
Sequence
MSQDKIAAHFQLSLAAMTAAAGDATLLAASRAIAAASIKALEQGRKILLAGNGGSAADAQ
HIAAEIIGRYKRDRAAWPAVALTTDTSALTAIANDYGFERVFARQVEGLGQPGDVFIGIT
TSGRSPNILAALEVARQRGLVTVGMTGPSGGSMGALCDHLLIAPGPETALVQQIHLMAAH
AICDEIEVVLGKPAP
Download sequence
Identical sequences Q6N2R2
WP_011159523.1.60452 WP_011159523.1.81860 gi|39937048|ref|NP_949324.1| 258594.RPA3987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]