SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407938833|ref|YP_006854474.1| from Acidovorax sp. KKS102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407938833|ref|YP_006854474.1|
Domain Number 1 Region: 7-222
Classification Level Classification E-value
Superfamily Folate-binding domain 4.24e-49
Family Aminomethyltransferase folate-binding domain 0.00057
Further Details:      
 
Weak hits

Sequence:  gi|407938833|ref|YP_006854474.1|
Domain Number - Region: 224-301
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000163
Family Aminomethyltransferase beta-barrel domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407938833|ref|YP_006854474.1|
Sequence length 305
Comment glycine cleavage T protein (aminomethyl transferase) [Acidovorax sp. KKS102]
Sequence
MTYPLNGIAHLSHLGVIRVEGEDAAKFLHGQLTQDFALLGMDQARLAAFLSAKGRMQASF
IGFKRSATEVLLVCSRDLLPATLKRLSMFVLRAKAKLTDATGDFALYGIAGDAINAVAGS
AQPAWSKADLGTATLVHLYPADGTPRALWVAAATEPAPAGPALDATLWLWSEVISGVATL
TTPVVEAFVPQMLNYESVGGVNFKKGCYPGQEVVARSQFRGTLKRRAYIAHAAAEVAVGA
EVFSTSDLEQPCGTVVQVAAAPGGGFDTIVSLQISAAQEGALQVGAAGGVPLSLLPLPYP
LLDDI
Download sequence
Identical sequences K0I9S1
WP_015013855.1.5072 gi|407938833|ref|YP_006854474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]