SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407937003|ref|YP_006852644.1| from Acidovorax sp. KKS102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407937003|ref|YP_006852644.1|
Domain Number 1 Region: 10-146
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000068
Family Rob transcription factor, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407937003|ref|YP_006852644.1|
Sequence length 163
Comment transcription activator effector-binding protein [Acidovorax sp. KKS102]
Sequence
MTTIPTRTAVAAFHVVGLTVRTCNRDEMDPATGRIGALWDRFFSQSWERTLPSRGEEGRI
FGVYSGYESDQYGAFDVTAGVAVPPPVAPVPRAVQIAVQAGDYLVFHGHGTMPQMVIDAW
GEVWRYFAAHPQLPRRFGTDFELYEGPDRVAIHIGIAPGAPRA
Download sequence
Identical sequences K0I555
gi|407937003|ref|YP_006852644.1| WP_015012101.1.5072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]