SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384227185|ref|YP_005618935.1| from Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384227185|ref|YP_005618935.1|
Domain Number 1 Region: 295-429
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-19
Family CBS-domain pair 0.0075
Further Details:      
 
Domain Number 2 Region: 439-519
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.12e-16
Family CorC/HlyC domain-like 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|384227185|ref|YP_005618935.1|
Domain Number - Region: 7-224
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000706
Family LacY-like proton/sugar symporter 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384227185|ref|YP_005618935.1|
Sequence length 521
Comment inner membrane protein [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)]
Sequence
MEFFLDPSTWAGLLTLVILEVVLGIDNLIFVAILSEKLPPNQRDKARLIGLGLALVMRLA
LLSLISWIVTLNSPIVHNKFFSLSIRDIILLFGGFFLLFKTTMELHERLENNHHENSENK
NYAGFWAVVIQIVVLDAVFSLDAIITAVGMVNQLLIMMIAVILATFLMLLASKALTNFIN
LHQTVVVLCLSFLLMIGFSLVTEALRFCIPKGYLYAAIGFSILIEIFNQIARHNFMKNQS
RRPMRQRAAEAILRLMVGEQNKKQQIKKIEINSQKTDSIQSSKEMETFKDEERYMINGVL
TLAGRSIRSIMTPRSNISWVNTEKNTDEIRMQLLDTPHSLFPVCKGELDEIIGIVRAKEL
LVAIEKKIDVSTFSSKILPIIIPDTLDPIKLLGVLRRAQGSFVIVSNEFGVVQGLITPLD
VLEAIAGEFPDADETPDIIQESNSWLVKGETDLHSLQQLLNTEELIKEDNYASLGGLLIA
QKGQLPIPGEIIHIHPFYFHIVKATEYRIDLVRIIKNQDDN
Download sequence
Identical sequences gi|384227185|ref|YP_005618935.1| WP_012619506.1.52070 WP_012619506.1.93284 WP_012619506.1.93731 gi|219682241|ref|YP_002468625.1| 561501.BUAPTUC7_317 gi|384226128|ref|YP_005617291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]