SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|69838|e_gw1.30.162.1 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|69838|e_gw1.30.162.1
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 6.47e-33
Family Nip7p homolog, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 5.1e-22
Family PUA domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|69838|e_gw1.30.162.1
Sequence length 185
Sequence
MRPLTEEETQAVFKKLAEYTGASLKNIIAPQEDGDRNVFRLSQNRVYLVRLSMANLATSI
ARDNLLSLGTCLGKFTKSGKFRIHITALPILAEHARHKLWIRPNGVMPFLYGGNIVKAHV
GRYSEDCPEHQGLVVYTMDDVPLGFGVSARSTAESRRLDPTGVMCFRQADCGEYLRDEDT
LFQSG
Download sequence
Identical sequences A0A024RZJ9 G0RVQ2
51453.JGI69838 XP_006969307.1.9351 jgi|Trire2|69838|e_gw1.30.162.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]