SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|75304|estExt_GeneWisePlus.C_30418 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|75304|estExt_GeneWisePlus.C_30418
Domain Number 1 Region: 2-351
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.01e-109
Family IF2B-like 0.0000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|75304|estExt_GeneWisePlus.C_30418
Sequence length 373
Sequence
MSLLQAVKYQRGKLEVLDQLLLPHEFHYDTVSTRQEAFDSIATMRVRGAPAIAIVASLGL
AVELHNNSIAGTSDGEVIAQIDEALDYLKESRPTAVDLTNAINQLKATIRTAEGKGKDAI
VQAFIEEAERIFEKDLQSNLSIGEHGAQWLQARAGASPDHKISVLTHCNTGALATSGHGT
ALGIIRTLQSKGYLKHAFCTETRPYNQGSRLTAFELVHEGIPSTLITDSMAAALFRTKKA
ENNIAAVIVGADRVVRNGDTANKIGTYQLAVLAKHHGIKFIVAAPTTSIDLETETGDGIK
IEERKREELTQISGAVRVATADQRIDVWNPAFDVTPAEFIDVVVTEKGAVEKGPDGTFDF
SQILPERWAKVVG
Download sequence
Identical sequences G0RBZ0
jgi|Trire2|75304|estExt_GeneWisePlus.C_30418 XP_006962902.1.9351 51453.JGI75304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]