SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|75475|estExt_GeneWisePlus.C_30741 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|75475|estExt_GeneWisePlus.C_30741
Domain Number 1 Region: 951-1067
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-23
Family cAMP-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 756-872
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|75475|estExt_GeneWisePlus.C_30741
Sequence length 1090
Sequence
MSSSVTGFSPWRKRASSLASQTDQLHHDRTDAASHAESSMLEAGNPSHQQLSSSVGSAQG
YREPIRSFIHASLRDQLVPVDSAQNARSVREDTAELARYLLSDGSAQRRPSFLQRGRPSL
NEVFGPEFADADSIEGSIRRSSGTIPEVTEPPSPEDGEHGAQATGEDGPSALANLLKNSS
PPSSVSEQAKIPPPRFENLEAGHSQPSDIDEIQQRPETREAEASEYTPLLERPNLGSGTN
SSIDIEGQKSSARKRWLHGVTEQGRKVERRLVQFAKVASCPSRWNRKAIWETAVVEPVSC
LPAVAVGLLLNILDALSYGMILFPLGTPLFSHLGSAGISIYYVSTIVAQLVFSTGSIFKG
AVGSELIEVVPFFHNMAAKILDIVGEENPDAVIATTIVAYAMSSMLTGLVFYLMGRFKFG
FMVGFIPRHILIGCIGGVGWFLIATGFEVSARLEGSLEYDLDTLQKLMETKTIPLWICPL
ILAIILFYGQMKGASKYFLPLFILAIPLVFYLFVFSLDVLEPSTLRDHGWIFVGPPPDEP
WWYFYTLYQFHLVHWGAIIEVIPAMFALTFFGILHVPINVPALALNSGEDNADLDKELRL
HGYSNFLSGCLGSIQNYLVYANTVFFLRSGGNKRLAGYLLALLTFGVMIIGPSIIGWIPV
MMVGTLIFDLGFELLLEAVWLPRKKLRPAEYITVIIIVLVMGIYDFVVGIGVGILLAFVS
LTIQTSRVSAIRAIYDGEVVTSTVRRNPSQDSYLQRVGRQIHIMKLTGFLFFGTVVSVEA
KIRELLEEHTFAQKPIKFLILDMWHVTGLDYSAGEAFNTISRLLNNKGVHLILSGLDADS
ELGRNLRAVGLGSGGIEVMMLPDLNSALESCENELLKTLYAQQEELSTAKQATANLDVPT
TSTTLDSFDPPFNSPRRNHLVEAAYDALNSVDIQRRSRWQSFNEPLRLMLQIFQGLSDKN
EDFWFQAASYFVRKDYAAGTVLFRRGEPADGFYLLERGIIRAEYDLPQGRLCESIVAGTT
LGELPFFSETSRTATAQVERDCTVWVMDTEAWKRLQQKEPEIAREFLKISLKLTSERMSA
ITSYILTTAG
Download sequence
Identical sequences A0A024SFW7 G0RCH8
51453.JGI75475 XP_006962984.1.9351 jgi|Trire2|75475|estExt_GeneWisePlus.C_30741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]