SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|82380|estExt_GeneWisePlus.C_360050 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|82380|estExt_GeneWisePlus.C_360050
Domain Number 1 Region: 27-109,205-425
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.61e-58
Family IF2B-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|82380|estExt_GeneWisePlus.C_360050
Sequence length 440
Sequence
MPSVSSGHALDLEKFLKSLKGQPLEASINSLISLLKRRQIKGSEPCAVATAHILLQVVAR
SKWHDVDSLLINVSRTGRKLVDAQPNELVIGNIVRRVLGLIRDEASEDRGDAGDESASDA
PTPTDIVPPAATSQQWATRRLDSANSAAPAARPPIVSSYSSINPPKSLFHLLSTSPPADG
DVSPFRNSGASTPTWRGNSSQIHALRSEVIDGIEEIKDEISQVDDQIAASAEVQIHPGDL
VLVHQPSTTVERFILRAAQKRKFTVLIAVAPPRRHSAEGQHATFRKKLSAAGITVVNVMN
GGLMAYMSRVNKVIIGARAIVATGGVVADAGAAAIARAAKEQGTAVVVLSGVYKLSPESP
FDESSLIEWGDSSTFVSFADGPLVSGAEIRTALTELIQPELVDTYITNLGTHSRDHLSSL
ISDHYKREDADFHIWEEAEP
Download sequence
Identical sequences A0A024RVF9 G0RWQ0
51453.JGI82380 jgi|Trire2|82380|estExt_GeneWisePlus.C_360050 XP_006969663.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]