SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479272625|ref|YP_007845904.1| from Enterobacter cloacae subsp. cloacae NCTC 9394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479272625|ref|YP_007845904.1|
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000458
Family NfeD domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|479272625|ref|YP_007845904.1|
Domain Number - Region: 33-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000811
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479272625|ref|YP_007845904.1|
Sequence length 150
Comment Membrane protein implicated in regulation of membrane protease activity [Enterobacter cloacae subsp. cloacae NCTC 9394]
Sequence
MIELIVAHPHAFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPVGWEWQGALF
AVLTLLAAWLWWRWLNKRVKAQKPVDAHLNQRGQQIVGRRFTLDNALINGRGHMRVGDSS
WPVVADDDLSAGTRVEVIAVEGITLRVKAC
Download sequence
Identical sequences A0A0D9HF90 A0A179PMZ5 A0A181X015 A0A1V3XH15 A0A2J5VQ08
2030667240 2030690018 2030388940 2030328088 gi|479272625|ref|YP_007845904.1| 2031758499 WP_015571238.1.100009 WP_015571238.1.101104 WP_015571238.1.101715 WP_015571238.1.101854 WP_015571238.1.10710 WP_015571238.1.10864 WP_015571238.1.10865 WP_015571238.1.10971 WP_015571238.1.11167 WP_015571238.1.12067 WP_015571238.1.12196 WP_015571238.1.12290 WP_015571238.1.12513 WP_015571238.1.13462 WP_015571238.1.13869 WP_015571238.1.14059 WP_015571238.1.14427 WP_015571238.1.14856 WP_015571238.1.15044 WP_015571238.1.15357 WP_015571238.1.15748 WP_015571238.1.16030 WP_015571238.1.16085 WP_015571238.1.16122 WP_015571238.1.16149 WP_015571238.1.16310 WP_015571238.1.16350 WP_015571238.1.1654 WP_015571238.1.16810 WP_015571238.1.16848 WP_015571238.1.16853 WP_015571238.1.16863 WP_015571238.1.16943 WP_015571238.1.17510 WP_015571238.1.18075 WP_015571238.1.18491 WP_015571238.1.18544 WP_015571238.1.19007 WP_015571238.1.19570 WP_015571238.1.19610 WP_015571238.1.19966 WP_015571238.1.20193 WP_015571238.1.20871 WP_015571238.1.20995 WP_015571238.1.21870 WP_015571238.1.22223 WP_015571238.1.22430 WP_015571238.1.23892 WP_015571238.1.24240 WP_015571238.1.25550 WP_015571238.1.256 WP_015571238.1.26530 WP_015571238.1.26874 WP_015571238.1.26954 WP_015571238.1.27089 WP_015571238.1.28036 WP_015571238.1.29212 WP_015571238.1.29478 WP_015571238.1.29612 WP_015571238.1.29739 WP_015571238.1.30157 WP_015571238.1.30345 WP_015571238.1.30412 WP_015571238.1.30594 WP_015571238.1.30604 WP_015571238.1.30852 WP_015571238.1.31249 WP_015571238.1.31268 WP_015571238.1.31470 WP_015571238.1.31593 WP_015571238.1.3210 WP_015571238.1.3218 WP_015571238.1.32238 WP_015571238.1.32901 WP_015571238.1.3292 WP_015571238.1.32958 WP_015571238.1.34582 WP_015571238.1.34623 WP_015571238.1.35259 WP_015571238.1.35292 WP_015571238.1.35511 WP_015571238.1.36012 WP_015571238.1.36466 WP_015571238.1.37211 WP_015571238.1.37315 WP_015571238.1.37462 WP_015571238.1.37620 WP_015571238.1.37908 WP_015571238.1.38189 WP_015571238.1.38221 WP_015571238.1.38255 WP_015571238.1.39603 WP_015571238.1.40941 WP_015571238.1.41385 WP_015571238.1.41670 WP_015571238.1.41767 WP_015571238.1.41788 WP_015571238.1.41953 WP_015571238.1.41967 WP_015571238.1.42124 WP_015571238.1.42527 WP_015571238.1.42793 WP_015571238.1.42968 WP_015571238.1.43048 WP_015571238.1.43187 WP_015571238.1.44522 WP_015571238.1.44670 WP_015571238.1.4477 WP_015571238.1.45046 WP_015571238.1.45270 WP_015571238.1.45338 WP_015571238.1.4551 WP_015571238.1.45786 WP_015571238.1.45800 WP_015571238.1.4609 WP_015571238.1.46853 WP_015571238.1.4737 WP_015571238.1.48105 WP_015571238.1.48221 WP_015571238.1.48569 WP_015571238.1.48574 WP_015571238.1.48760 WP_015571238.1.48920 WP_015571238.1.49440 WP_015571238.1.49618 WP_015571238.1.49652 WP_015571238.1.49797 WP_015571238.1.49826 WP_015571238.1.49836 WP_015571238.1.50391 WP_015571238.1.50494 WP_015571238.1.51121 WP_015571238.1.51196 WP_015571238.1.51695 WP_015571238.1.51737 WP_015571238.1.51918 WP_015571238.1.51984 WP_015571238.1.52556 WP_015571238.1.52580 WP_015571238.1.52918 WP_015571238.1.52938 WP_015571238.1.53160 WP_015571238.1.53164 WP_015571238.1.54084 WP_015571238.1.54584 WP_015571238.1.54933 WP_015571238.1.55300 WP_015571238.1.56418 WP_015571238.1.56618 WP_015571238.1.56802 WP_015571238.1.56919 WP_015571238.1.57007 WP_015571238.1.5717 WP_015571238.1.57317 WP_015571238.1.57436 WP_015571238.1.57454 WP_015571238.1.57605 WP_015571238.1.57748 WP_015571238.1.57779 WP_015571238.1.59408 WP_015571238.1.59623 WP_015571238.1.59653 WP_015571238.1.60053 WP_015571238.1.60141 WP_015571238.1.60892 WP_015571238.1.60951 WP_015571238.1.61545 WP_015571238.1.61725 WP_015571238.1.61909 WP_015571238.1.62117 WP_015571238.1.62125 WP_015571238.1.63 WP_015571238.1.63396 WP_015571238.1.63447 WP_015571238.1.64354 WP_015571238.1.64612 WP_015571238.1.64623 WP_015571238.1.64642 WP_015571238.1.65594 WP_015571238.1.65618 WP_015571238.1.6567 WP_015571238.1.65877 WP_015571238.1.6631 WP_015571238.1.6651 WP_015571238.1.66660 WP_015571238.1.66944 WP_015571238.1.67088 WP_015571238.1.67439 WP_015571238.1.67474 WP_015571238.1.680 WP_015571238.1.68316 WP_015571238.1.68400 WP_015571238.1.68405 WP_015571238.1.68694 WP_015571238.1.68950 WP_015571238.1.69141 WP_015571238.1.69196 WP_015571238.1.69289 WP_015571238.1.69423 WP_015571238.1.69874 WP_015571238.1.70419 WP_015571238.1.70469 WP_015571238.1.70812 WP_015571238.1.70819 WP_015571238.1.70825 WP_015571238.1.71173 WP_015571238.1.71244 WP_015571238.1.71422 WP_015571238.1.71449 WP_015571238.1.72354 WP_015571238.1.72395 WP_015571238.1.74068 WP_015571238.1.74669 WP_015571238.1.74910 WP_015571238.1.75359 WP_015571238.1.75512 WP_015571238.1.76349 WP_015571238.1.76483 WP_015571238.1.76665 WP_015571238.1.76688 WP_015571238.1.77076 WP_015571238.1.7769 WP_015571238.1.77910 WP_015571238.1.77937 WP_015571238.1.78743 WP_015571238.1.79517 WP_015571238.1.80075 WP_015571238.1.80933 WP_015571238.1.81363 WP_015571238.1.82926 WP_015571238.1.83133 WP_015571238.1.83194 WP_015571238.1.83391 WP_015571238.1.83453 WP_015571238.1.8355 WP_015571238.1.83903 WP_015571238.1.84101 WP_015571238.1.84425 WP_015571238.1.84479 WP_015571238.1.84709 WP_015571238.1.85159 WP_015571238.1.85482 WP_015571238.1.86111 WP_015571238.1.87337 WP_015571238.1.87781 WP_015571238.1.87950 WP_015571238.1.8833 WP_015571238.1.88938 WP_015571238.1.88978 WP_015571238.1.89338 WP_015571238.1.89490 WP_015571238.1.89597 WP_015571238.1.89743 WP_015571238.1.90685 WP_015571238.1.90765 WP_015571238.1.90966 WP_015571238.1.91323 WP_015571238.1.91359 WP_015571238.1.91575 WP_015571238.1.92050 WP_015571238.1.92287 WP_015571238.1.92293 WP_015571238.1.92542 WP_015571238.1.93102 WP_015571238.1.93429 WP_015571238.1.93751 WP_015571238.1.93980 WP_015571238.1.94120 WP_015571238.1.94939 WP_015571238.1.95252 WP_015571238.1.96147 WP_015571238.1.97115 WP_015571238.1.9777 WP_015571238.1.97924 WP_015571238.1.97933 WP_015571238.1.98287 WP_015571238.1.9846 WP_015571238.1.98887 WP_015571238.1.99807 WP_015571238.1.99951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]