SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479273501|ref|YP_007846780.1| from Enterobacter cloacae subsp. cloacae NCTC 9394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479273501|ref|YP_007846780.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.1e-109
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.83e-39
Family N-terminal domain of adrenodoxin reductase-like 0.0000012
Further Details:      
 
Domain Number 3 Region: 469-628
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.25e-25
Family C-terminal domain of adrenodoxin reductase-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479273501|ref|YP_007846780.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Enterobacter cloacae subsp. cloacae NCTC 9394]
Sequence
MSRYPSLFAPLDLGFTTLKNRVLMGSMHTGLEERPDGAERLAAFYAERARHGVALIVTGG
VAPAPSGVTMEGGAVLNDASQLPHHRIVTDAVHREGGKIALQILHTGRYSYQPNLVAPSA
IQAPINRFTPHALSHDEILALIDDFARCAALAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDEWGGDYARRMRFAVEVVRAVRERAGADFIIIFRLSMLDLVEGGGTFDETVQLAQAIE
AAGATIINTGIGWHEARIPTIATPVPRAAFSWVTRKLKGIVSVPLVTTNRINDPQVAEDV
ISRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPR
ACHETKMPIVPAVNKKRLAVVGAGPAGLAFAVNAASRGHSVTLFDALAEIGGQFTIARQI
PGKEEFYETLRYYRRMIEVTGVDLRLKQFVSAADLIGFDEVILASGIAPRTPAIEGIDHP
KVLSYLDVLRDKAPVGEKVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLS
QSGGLRPEGPQLPKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLSRGVKMIPGVSYQK
IDDDGLHVLIGGEPQLLRVDHVILCAGQEPKRDLADPLREAGKTVHLIGGCDVAMELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A0A2G5AG48
gi|479273501|ref|YP_007846780.1| WP_015571935.1.48221 WP_015571935.1.54197 WP_015571935.1.68950 WP_015571935.1.83675 WP_015571935.1.99169 WP_015571935.1.99422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]