SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77464092|ref|YP_353596.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77464092|ref|YP_353596.1|
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily SPOC domain-like 6.47e-45
Family Ku70 subunit middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77464092|ref|YP_353596.1|
Sequence length 262
Comment Ku protein [Rhodobacter sphaeroides 2.4.1]
Sequence
MAPRSYWKGYLKLSLVTCPVTLMPATSEAERVRFRTLNGRTGHPVVSRYLDAETGDVVDD
DDQVKGYPRSETEHVILEEEELDAVALESARTIDIDCFVPSDEIAWIWYDRPHYLMPADP
IGEEAFAVIREAMRATDRSGVARLVLGGRERAVLLMPRGEGIILWTLRYGDEVRPEEAYF
GDLAAGKPDPKALTLVKRLIEERTRTWEPGMVEDPVQENLLELIRSKKPKKRSRKAGAKA
PKGGDNVVSIMDALRKSIEGKG
Download sequence
Identical sequences Q3J0I9
WP_011338292.1.22285 WP_011338292.1.62547 WP_011338292.1.80699 WP_011338292.1.8565 YP_353596.1.90827 APC63672 gi|77464092|ref|YP_353596.1| 272943.RSP_0523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]