SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77464093|ref|YP_353597.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77464093|ref|YP_353597.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily SPOC domain-like 1.08e-50
Family Ku80 subunit middle domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77464093|ref|YP_353597.1|
Sequence length 267
Comment Ku protein [Rhodobacter sphaeroides 2.4.1]
Sequence
MPRAIWKGWLAVGEVSCAVALHAAASTSDRVSFHTVNRKTRNRVRREFVDAVSGKPVPRE
DQVKGYEVAPDEFVQIDPDEIAATIPDSDKCLRIDAFVPCREVDGAYFDKPYYLTPAGDA
ALEAFALIREGMRARKAAALARTVLFRRLRTVMVRPYGAGLIANTLNFDYEVRSSAEAFS
EIPKLKVKGEMLELAKHIIGTKAGTFDPAAFDDRYDAALADLVKAKLEGRKPKRKAAPKK
AREPSDLMAALRESVAATERPRRRKAG
Download sequence
Identical sequences Q3J0I8
272943.RSP_0524 gi|77464093|ref|YP_353597.1| WP_011338293.1.22285 WP_011338293.1.62547 WP_011338293.1.80699 WP_011338293.1.8565 YP_353597.1.90827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]