SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77465254|ref|YP_354757.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77465254|ref|YP_354757.1|
Domain Number 1 Region: 5-315
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.89e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000335
Further Details:      
 
Domain Number 2 Region: 419-516
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 2.41e-39
Family D-aminopeptidase, middle and C-terminal domains 0.0000513
Further Details:      
 
Domain Number 3 Region: 333-413
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 1.31e-31
Family D-aminopeptidase, middle and C-terminal domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77465254|ref|YP_354757.1|
Sequence length 516
Comment D-stereospecific aminopeptidase [Rhodobacter sphaeroides 2.4.1]
Sequence
MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPIC
SISKQFTCGALLDTLGDTAAYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQG
AEAAQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRIVSEILESETGRALRDLYAERI
FGPAGMRTAELTSDTRHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYES
WIDATRNDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGVKVTGHGGALRGFRAQRFH
AADERLSVVVIFNHEASAHAAASSLLAAALGHEAPKGARPEGWAGQWLDPESGLLLRVGE
DAEGLTLRFATGPDRLTAGEDGVPRGAGVSLAREGAMLVMNRTSDNLTVRAEPLPVVAVA
DAGEIAGRYHARELEADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDVWIVTTRRSMD
APAPGDWTLQVRREGGAVTGLRLGCWLARRIDYARV
Download sequence
Identical sequences Q3IX78
WP_011339153.1.22285 WP_011339153.1.62547 WP_011339153.1.80699 WP_011339153.1.8565 YP_354757.1.90827 272943.RSP_3246 gi|77465254|ref|YP_354757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]