SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|552535900|ref|YP_354238.2| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|552535900|ref|YP_354238.2|
Domain Number 1 Region: 9-321
Classification Level Classification E-value
Superfamily SIS domain 4.45e-59
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|552535900|ref|YP_354238.2|
Sequence length 321
Comment Sugar phosphate Isomerase [Rhodobacter sphaeroides 2.4.1]
Sequence
MTSSTTDFLATARRVIEAETTALTMLGASLDDSFGAAVETILRARGRVIVSGMGKSGHIG
RKITATLASTGTPAQFVHPAEASHGDLGMVTRDDVALVLSNSGETPELADIIAHTRRFDI
PLIGVASRAQSTLLRQSDVALLLPPAPEACGNGIVPTSSTTMTLALGDALAVALMEHRQF
TPEHFRVFHPGGKLGARLARVADLMHRDLPLVAMGTSMGEALITMSRLGFGVLGVTGPEG
RLAGIITDGDLRRHLDGLLSLSVEDVMTRHPLTIAPDALAEKAVAVMNGRKITSLFVVDP
EGSGAAEGLIHIHDCLRAGVA
Download sequence
Identical sequences Q3IYP7
gi|552535900|ref|YP_354238.2| WP_017139988.1.22285 WP_017139988.1.62547 WP_017139988.1.80699 WP_017139988.1.8565 YP_354238.2.90827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]