SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77404675|ref|YP_345249.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77404675|ref|YP_345249.1|
Domain Number 1 Region: 32-336
Classification Level Classification E-value
Superfamily SIS domain 1.01e-45
Family double-SIS domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77404675|ref|YP_345249.1|
Sequence length 337
Comment Sugar isomerase (SIS) [Rhodobacter sphaeroides 2.4.1]
Sequence
MLNFNEDRFLRIQSGAVALAPRIDAEIGAAIAAGATNLYFLGTGGVAYLMEPAVQLLHRR
SGFPTFKDYPAELILTGSANLTDKSIVVMPSLSGATKESVAMLEKLKEVGAKIITLVGHA
DTPLGLGGNPALVNFAEDDTSSESFYLQSLLIALSVMKARGEIDTYDALVAELQTVPAAL
VAAKKAFEPKAEDHARLIAGADYHMFTGAGNMWPEALYYATCILEEMQWIRTRPVHASDF
FHGPLELIEPGVSLVLFRGEDAYDPLAERVAQFARQYTDRLTVISTADYCPQTLSPELRA
MISPAVMATLMERLSAHLEVMRDHPLVTRRYYKRVAY
Download sequence
Identical sequences Q3IVC6
gi|77404675|ref|YP_345249.1| WP_011331318.1.22285 WP_011331318.1.62547 WP_011331318.1.80699 YP_345249.1.90827 272943.RSP_3956 gi|499650584|ref|WP_011331318.1|NZ_AKBU01000004 gi|499650584|ref|WP_011331318.1|NZ_AKVW01000004 gi|77404675|ref|YP_345249.1|NC_007488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]