SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77404691|ref|YP_345265.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77404691|ref|YP_345265.1|
Domain Number 1 Region: 35-303
Classification Level Classification E-value
Superfamily SIS domain 2.97e-17
Family double-SIS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77404691|ref|YP_345265.1|
Sequence length 312
Comment putative phosphosugar isomerase [Rhodobacter sphaeroides 2.4.1]
Sequence
MNLPAGSSLSRATALAGPFDAAGHRRDLEAALAAAETAARWIPALSVERLVLVGGGEAQL
LAQPALDLVGRTSRLASFALASEEARIGLPPERAPGTLVLLSAPDPDLAETLAARGAAVW
TLAPMAPEALCLQALAWAVHLLAARGEIAAPDAVREGLAALPRDLGPAKAAFEPEAARLA
ARLRAEPYQIVTGAGGAWPVAHRFALSALERGLRLPARPVHAADFFHGTLELIEPGVSLL
LVKGEDALRPLTLRVERFVGRYTDRLRIVDAAAAELPGLGPRLRALATPVILAALLERVE
AHLGPPAPRPGD
Download sequence
Identical sequences Q3IVB0
272943.RSP_3940 gi|499650597|ref|WP_011331331.1|NZ_AKBU01000004 gi|499650597|ref|WP_011331331.1|NZ_AKVW01000004 gi|77404691|ref|YP_345265.1|NC_007488 gi|77404691|ref|YP_345265.1| WP_011331331.1.22285 WP_011331331.1.62547 WP_011331331.1.80699 WP_011331331.1.8565 YP_345265.1.90827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]