SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77461985|ref|YP_351489.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77461985|ref|YP_351489.1|
Domain Number 1 Region: 3-323
Classification Level Classification E-value
Superfamily SIS domain 1.44e-36
Family double-SIS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77461985|ref|YP_351489.1|
Sequence length 334
Comment putative glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [Rhodobacter sphaeroides 2.4.1]
Sequence
MSYRSTIARQPEALADTHATVLDQLGAADLSGLLRPVIGVTGIGASFAAAVVGAAELQAR
GQRGVAIRACDLAAGHDLADTLVGLSAGGRSIETVTAFQKLPSAKRIGISQDGAGPLAGV
SDFHLTIRQGADATPSSVGYTATLLGMGMLFDRLLGADGTGFADLPAVVEEVLSQAADKM
ARIGTQFADRRAIDCVGAGAALGTADGASLLIREAARLPASAYDTRHYLHGPLEAMDATT
GVLIIGDGREVELARQVERIGCPVVLVTTDRSVQDGDGLTVIHVPRRDNLIAQGIVDILA
PQLIAAQLSDAAGLTDVKFRYRMQDTKVKTDAAA
Download sequence
Identical sequences Q3J6J6
WP_011336747.1.22285 WP_011336747.1.62547 WP_011336747.1.80699 WP_011336747.1.8565 YP_351489.1.90827 403386 gi|77461985|ref|YP_351489.1| 272943.RSP_1447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]