SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|77465598|ref|YP_355101.1| from Rhodobacter sphaeroides 2.4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77465598|ref|YP_355101.1|
Domain Number 1 Region: 71-211
Classification Level Classification E-value
Superfamily CBS-domain pair 4.8e-30
Family CBS-domain pair 0.0034
Further Details:      
 
Domain Number 2 Region: 214-293
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.18e-17
Family CorC/HlyC domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|77465598|ref|YP_355101.1|
Sequence length 315
Comment CorC/Hlyc family protein with CBS domains [Rhodobacter sphaeroides 2.4.1]
Sequence
MDSSSDGSMAAQSAPDQTEDDQAEPGPKGLFGRLFSAFSPAEAGGGALSPQDRAFAIAQS
SLTLPGIANLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPL
GLVLLKDLALQHGFNGNGSFDLKTLLRPLLYAPPSMPIGVLLQKMQRERVHMALVIDEYG
GVDGLVTIEDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIGLRLRR
EEEDEEIDTLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVRLPGAVAAP
VGGRALPAEQPLHSG
Download sequence
Identical sequences Q3IW84
272943.RSP_3597 APC63687 gi|77465598|ref|YP_355101.1| WP_011339442.1.22285 WP_011339442.1.62547 WP_011339442.1.80699 WP_011339442.1.8565 YP_355101.1.90827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]