SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86749962|ref|YP_486458.1| from Rhodopseudomonas palustris HaA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86749962|ref|YP_486458.1|
Domain Number 1 Region: 7-96
Classification Level Classification E-value
Superfamily YccV-like 4.18e-34
Family YccV-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86749962|ref|YP_486458.1|
Sequence length 110
Comment hemimethylated DNA-binding region [Rhodopseudomonas palustris HaA2]
Sequence
MIKTRTAKFQIGQIVRHRIFSFRGVVFDIDPEFNNTEEWWLSIPEEVRPHKDQPFYHLLA
ENADSEYVAYVSEQNLLPDDSGEPIRHSQVAEIFVKDKAGGYRPRNPSLN
Download sequence
Identical sequences A0A1H8SU96 Q136Y3 Q2IW63
316057.RPD_2627 316058.RPB_2845 2005385574 gi|91977098|ref|YP_569757.1| WP_011441732.1.14473 WP_011441732.1.50975 WP_011441732.1.68018 gi|86749962|ref|YP_486458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]