SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 27472.m000301 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  27472.m000301
Domain Number 1 Region: 69-105
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000118
Family H-NS histone-like proteins 0.0068
Further Details:      
 
Domain Number 2 Region: 127-163
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000022
Family H-NS histone-like proteins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 27472.m000301
Sequence length 253
Comment DNA-binding protein HU, putative
Sequence
MTTLDNLQAKIARLQAQAEALAAKQSVGVIAKIRDLMEKHSLTVADIEAHTGGKKRGRKP
GARTVAKPAASAKYRHPKTGATWTGHGRAPTWIASARDRTKFLIDDSAAQPATAAKKPAT
TGNYVRGPQAPKYRDPKSGATWSGRGPAPAWLAGAKDRSKFLIVAAEEGASGSKTISSGK
ATAKKATTKKVAGKTVTAKKAKAVTKSTPAKKTAVRKTAAKESVARKVPAKRAPQNLVAA
APTSDSASVPLVA
Download sequence
Identical sequences B9T7H3
27472.m000301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]