SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29188.m000052 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29188.m000052
Domain Number - Region: 47-129
Classification Level Classification E-value
Superfamily NHL repeat 0.00068
Family NHL repeat 0.038
Further Details:      
 
Domain Number - Region: 706-751
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0902
Family H-NS histone-like proteins 0.0063
Further Details:      
 
Domain Number - Region: 617-741
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0942
Family MW0975(SA0943)-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29188.m000052
Sequence length 760
Comment conserved hypothetical protein
Sequence
MDSPSSSSSRQSLTPKEDIQWVPLTSHPLFATTTGTAAAATPPRNLLAWDGSSRLYYWDS
NKQCLHRISIRLGDPEPTSVLASIPSKVLRADVDINFVVNNISINKNGTALFLSGSDGLC
VIYLYGRANAKDNAIICRTVSVGSQIYFNENSVIRTLQEYYLQPVEPGRSRNASSICPVD
FSFGGDHLWDRFSVFILFSDGLIYILCPIVPFGSVHKLESVLEIYSDAQTFGLKSTNQTA
VSNSNFAISWLEATFPELNDEAIERDDLLTLKARPYALFDASLCLQGPLRKVHGGEDEYS
AVRGTQCEGCAISFLYNIVSKDSILVTAWSGGQLQIDALADEIQPVWTVGSPPRLHVDSH
DHILAVAMICESISGEIPVVKLDQPLDHTVWLGHPPPLLRLAIVDLALPRKMESGSKITM
FADPLLPEKIYSVHDGGIDSILLHFLPFTSQSCGKDETLRTPSVHPLLSTRQADNSSPLC
GFVTLSDAFGYSWIIGVTSMQECIVLEMKTWDSLLLSHVDVEKKSPGSEERKEGNTLDII
SKELLSGPKVVLLPQASPNLRSVAADSIEGRSALHQYFKLFHENYVEYAHKVYFELKHHE
PQLKRIIDDQNARLDAAEEKLLKVEEKQLGLDDRIGHAINAHSLLEQRLQHLRNLPGAHK
KPLSRAEREFKSELDNFTGIELDALRATIDTLRARLKRFTQSPRAKVLNQQRQMSGKNYV
RDVQISQLKSSLAKLSLVNNENSKKVKLVESVLKSQESSK
Download sequence
Identical sequences B9T865
29188.m000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]