SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29709.m001177 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29709.m001177
Domain Number - Region: 41-150
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0458
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29709.m001177
Sequence length 179
Comment hypothetical protein
Sequence
MSNLIIAPRKKISPPRNTWRGWFRYFHYDETKDSPNEARNVLLVVMALIAAVTFQSGVNP
PGGVWQDNDGHHAGRAIYAFQPHTFYVFLVSSTLALSTSLLVIVSLTYRFPLHLEIWVAT
ASMIVTYASAIFAVTPRENVKVCYILITAALPLIMRILIQMLRQLKSEANEPVTEVDEG
Download sequence
Identical sequences B9SKE4
29709.m001177 XP_002526474.1.68434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]