SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29929.m004770 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29929.m004770
Domain Number - Region: 57-188
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.00445
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29929.m004770
Sequence length 195
Comment Photosystem II core complex proteins psbY, chloroplast precursor (L-arginine-metabolizing enzyme) (L-AME) [Contains: Photosystem II protein psbY-1 (psbY-A1); Photosystem II protein psbY-2 (psbY-A2)], putative
Sequence
MATMAILNTKCLSNINSGKNINKPTTTKPISLLSMQELPKGLTISKPTNENKLLAGTAIA
GAIFSTLSSCDPAFAAQQIAEIAEGDNRGLALLLPIIPALGWVLFNILRPALNQINRMRE
TKGVIIGLGLGGLAATGFMAAAPEASASENIAMIADAASDNRGQLLLFVVAPAILWVLYN
ILQPALNQINRMRSE
Download sequence
Identical sequences B9RMR5
29929.m004770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]