SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 30205.m001598 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  30205.m001598
Domain Number - Region: 13-77
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0209
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 30205.m001598
Sequence length 180
Comment conserved hypothetical protein
Sequence
MAPGRVQRDLIGPLLAVNLIVHLIVLGLAGWSLDKYIDGQQDHPHLGGNPSTSFMLVYAL
IAGVIGASSVLIGILHFRSWRSDSLASATSLAINSWAIAALAFGLVCQQIILGGHRGKRL
KTLEALITVSFLSQLLYLLLLHAGMFNPRYGPGFHNHECDRGPGIARSIEPQTANTSAVI
Download sequence
Identical sequences B9RSM4
XP_002516743.1.68434 30205.m001598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]