SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 30288.m000025 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  30288.m000025
Domain Number - Region: 2-55
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00801
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 30288.m000025
Sequence length 94
Comment conserved hypothetical protein
Sequence
MQSARARTALLSAVLRWRNAQRRELRVIGLIAPKEDDESAARINNALIQGLLLLRTARAP
GRCCPLCYLYCVTLHKTLFPGIGIAETRLSNCVS
Download sequence
Identical sequences B9TGI9
30288.m000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]