SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 30671.m000033 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  30671.m000033
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.00000000000209
Family Kis/PemI addiction antidote 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 30671.m000033
Sequence length 76
Comment conserved hypothetical protein
Sequence
MPMQALKLTQIGNSVGLILPKETLSRLKLEKGDTVYLTDAPGGVTLTPHDPTFEEQLELG
REFMREYRDTFNALAK
Download sequence
Identical sequences B9TK37
30671.m000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]