SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31036.m000037 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31036.m000037
Domain Number 1 Region: 77-192
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.26e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Homeodomain-like 4.79e-19
Family Tetracyclin repressor-like, N-terminal domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31036.m000037
Sequence length 199
Comment conserved hypothetical protein
Sequence
MGRHREFDVDEALEAALRVFWRKGYEGTSYTDLTEATGVARPALYSAFGNKEDLFRQVLT
RYYAEYLAFFPAAMAQPTARKVVEKIFSDAAELHTRYHDRRGCLGIHGALAGSDEVAAIQ
AALIDARNAGEETLRQRLELAQRQGDLPAHADPAILAGFVLMVLHGMAVQAKAGVERATL
DAVAAQALAGWPSPVDNDL
Download sequence
Identical sequences B9TGT0
31036.m000037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]