SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 32278.m000027 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32278.m000027
Domain Number 1 Region: 130-166
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000628
Family H-NS histone-like proteins 0.0055
Further Details:      
 
Domain Number 2 Region: 72-107
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000785
Family H-NS histone-like proteins 0.0053
Further Details:      
 
Domain Number 3 Region: 205-242
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000706
Family H-NS histone-like proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 32278.m000027
Sequence length 243
Comment conserved hypothetical protein
Sequence
MATLQSLKARIAKLQAQAEAIVKKDSSAVIEKIRGIMEKHGITTADIDAHIGGGAKKRGR
KPGVKAAAKSPASAAKYRDPKTGATWTGHGRAPAWIASAKDRSKFLVEDNAVSSAPPTKK
SAKAGNYIRGPQPALYRDPKTGATWSGRGRAPAWIANAKDRSKFLIAGAAEGVVATNAGV
VSKTKTAVKKASKAIGATSTKGQPKGPQPALYRDPKSGATWSGRGRAPAGLAGAKDRSKF
LIV
Download sequence
Identical sequences B9TEM8
32278.m000027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]