SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 32630.m000015 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  32630.m000015
Domain Number - Region: 40-215
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0183
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 32630.m000015
Sequence length 298
Comment High-affinity branched-chain amino acid transport system permease protein livH, putative
Sequence
MAYFLQQILNAVPIAALYAALAFGYAIAFAITKRADVTFGGIFAFAGLTCLLFADFGWNR
LWLTLAATLAFGAVAGLFGGLWAGFLIGRAVMRPLAQATPNAVTVASIGALIALMESARL
AADTRSLWLPPLFNDPVRLWQQGDFLVTTTPMQILNSACFCALIAAGWLFLRSSQCGRQW
RAVSEDDFAARLMGVNAGRVFLLSYCAAALIASVCGVLATFYYGNMDFGAGLTFGLKVVL
ISAAGGYSSPLKSAAGAAAIGIGETFWSAYGAVTWRDAGVLLMLILWLIAARSERPVL
Download sequence
Identical sequences B9TKA9
32630.m000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]