SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 32740.m000032 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  32740.m000032
Domain Number 1 Region: 27-89
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000165
Family Tetracyclin repressor-like, N-terminal domain 0.0094
Further Details:      
 
Weak hits

Sequence:  32740.m000032
Domain Number - Region: 99-180
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0189
Family Tetracyclin repressor-like, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 32740.m000032
Sequence length 217
Comment conserved hypothetical protein
Sequence
MQTKEKPAKKGTIPAKGGPSPKELAVVRQKHVLKIATSEFFERGFDGTTIDRIAVLAEAS
KATIYKRYRSKEELFEAVVLEVASNIATHPVKFDESDIEGSLRAWGKAAYKTSTSRQAVE
LLRLIIAEGAKQPELVRHIREIYIERSIGELIQFFSLLRKHNRIIDTDPAELAISFSLNV
LGGFRHLLGVSETPGAVSKRIENAVVIFSQGCMRNSR
Download sequence
Identical sequences B9TER0
32740.m000032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]