SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 33704.m000034 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33704.m000034
Domain Number 1 Region: 36-80
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00004
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33704.m000034
Sequence length 94
Comment conserved hypothetical protein
Sequence
MARTVDVAAPSFDNHLAGLNALTLALGGRISEQLSLGLIYLDFARTDPVLYRLMFGEDRH
SFSRRRRGTSYATARRLRSSPIELIGAHEVALQR
Download sequence
Identical sequences B9TDJ3
33704.m000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]