SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 34270.m000027 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  34270.m000027
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000872
Family Tetracyclin repressor-like, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 82-209
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000156
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 34270.m000027
Sequence length 209
Comment conserved hypothetical protein
Sequence
MQKNTPRREDGLSRERIIDEAIGLLDSNGEGGLTFRALAERLSTGAGAIYWHVANKHDLM
VAACDAVLARALAAPLATRTPQDAIRALALALFDAIDQRSWIGAVLTRAPLQSPVVRILE
PLGQQVRAMGVAPGQQLTVASALLSYILGVSVQNAANAQIGRRLGGHRDALLGAAAEAWT
ALDADAYPFTRSVASVLRQHDDRADYLAG
Download sequence
Identical sequences B9TM14
34270.m000027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]