SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 50659.m000017 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  50659.m000017
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily Homeodomain-like 7.18e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 77-196
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000131
Family Tetracyclin repressor-like, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 50659.m000017
Sequence length 276
Comment conserved hypothetical protein
Sequence
MAGIKQFNEDDALERAMHVFWRQGYGATSMPDLAKATGVQRGSLYHAYGDKQNIFLLAFA
RYQRHYLEMVRRNMRLDDPEAALRAYFAYVIGSMSEPVPPLDDTPSSRTRGCLTTKIATD
ETAMDEPVRNALRDMLEGLAAVLEERLSQPDARERLVLSPKDAARLLVTFTRGNVVMERI
YHDQQQLQATADSMIQEFAHFVRLIDIQREPFGRAPGLADFRHQRMQLGRAARAQHHVMA
LAGQLACCGGTASPAGAGNQNNLAMSFRHDASSPGH
Download sequence
Identical sequences B9TJR0
50659.m000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]